PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT18945
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 505aa    MW: 55590.5 Da    PI: 4.8103
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT18945genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.72e-11340386147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+ WT eE++ ++ + + +G g+Wk I++++ +++t+ q+ s+ qk+
         EMT18945 340 RKLWTIEEHKSFLYGLEIYGRGDWKNISKHFVTTKTPVQVSSHAQKF 386
                      567******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129312.314338391IPR017884SANT domain
SuperFamilySSF466893.88E-15339392IPR009057Homeodomain-like
SMARTSM007179.8E-9339389IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.9E-12339389IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.6E-9339393IPR009057Homeodomain-like
PfamPF002495.0E-8340385IPR001005SANT/Myb domain
CDDcd001671.29E-7343387No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MSPENTTTAA HGSGVDATVA PLAAGDEEEH EHVQLGELGP LVASMVLEGD RGGRSELADD  60
GRGSAELREV RDDPDQQGPL VSGSGHGTER GWGGSVIQGW TSSQVEEARS LIARLNTNKI  120
MYNANDDKNK KHNYIVNSLH ALFPSKTMQQ LREGTHVTGG SPQNMLTFCE PVNGNYELPG  180
EKNGASNIHG VYTMGDHANG NFGVREEEAT IVDNNGLSFG CVMEDTGITV TGEAPLMVDN  240
NKMVVLVNNI SIDQPVVAPH QWDFWTNKEH SMGDLVNENF EVQEDEDTNM DDNGFPFRCA  300
LEDTRITKTE EARMMADKNK MVLLENNTSN DRPAVAPHQR KLWTIEEHKS FLYGLEIYGR  360
GDWKNISKHF VTTKTPVQVS SHAQKFFKRI QKKASSGTKR YSINDVRLHD NELLAANNSS  420
VPRQALSFTG LNNDPSFRLQ APTSSLTVMN NQAQCSPSTY NQQVDQQPMW SEQQMMGSVA  480
AVMDGIGNYV PDGQQGPAYF YLGNV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLR7WEJ40.0R7WEJ4_AEGTA; Myb-like protein J
STRINGMLOC_10707.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.13e-19Homeodomain-like transcriptional regulator